Lineage for d2r84a2 (2r84 A:100-334)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) 
Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
Pfam PF06973; DUF1297Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species) Species Pyrococcus furiosus [TaxId:2261] [160808] (4 PDB entries)
Uniprot Q8U0R7 100-334
Domain d2r84a2: 2r84 A:100-334 [151673]
Other proteins in same PDB: d2r84a1, d2r84b1
complexed with amp, amz, cl, mpd, na
Details for d2r84a2
PDB Entry: 2r84 (more details), 1.9 Å
PDB Description: crystal structure of purp from pyrococcus furiosus complexed with amp and aicar
PDB Compounds: (A:) PurP protein PF1517SCOPe Domain Sequences for d2r84a2:
Sequence, based on SEQRES records: (download)
>d2r84a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
drnlerkwlkkagirvpevyedpddiekpvivkphgakggkgyflakdpedfwrkaekfl
gikrkedlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdql
efdmditytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlef
vvfeisarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt
Sequence, based on observed residues (ATOM records): (download)
>d2r84a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
drnlerkwlkkagirvpevyedpddiekpvivkpgkgyflakdpedfwrkaekflgikrk
edlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdqlefdmd
itytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlefvvfei
sarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt
SCOPe Domain Coordinates for d2r84a2:
Click to download the PDB-style file with coordinates for d2r84a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r84a2:
- d2r84a2 first appeared in SCOP 1.75
- d2r84a2 appears in SCOPe 2.04
- d2r84a2 appears in SCOPe 2.06
- d2r84a2 appears in the current release, SCOPe 2.08
View in 3D
