Lineage for d2r84a2 (2r84 A:100-334)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433276Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 1433277Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 1433283Species Pyrococcus furiosus [TaxId:2261] [160808] (4 PDB entries)
    Uniprot Q8U0R7 100-334
  8. 1433286Domain d2r84a2: 2r84 A:100-334 [151673]
    Other proteins in same PDB: d2r84a1, d2r84b1
    complexed with amp, amz, cl, mpd, na

Details for d2r84a2

PDB Entry: 2r84 (more details), 1.9 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with amp and aicar
PDB Compounds: (A:) PurP protein PF1517

SCOPe Domain Sequences for d2r84a2:

Sequence, based on SEQRES records: (download)

>d2r84a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
drnlerkwlkkagirvpevyedpddiekpvivkphgakggkgyflakdpedfwrkaekfl
gikrkedlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdql
efdmditytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlef
vvfeisarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt

Sequence, based on observed residues (ATOM records): (download)

>d2r84a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
drnlerkwlkkagirvpevyedpddiekpvivkpgkgyflakdpedfwrkaekflgikrk
edlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdqlefdmd
itytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlefvvfei
sarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt

SCOPe Domain Coordinates for d2r84a2:

Click to download the PDB-style file with coordinates for d2r84a2.
(The format of our PDB-style files is described here.)

Timeline for d2r84a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r84a1