Lineage for d2r7ka2 (2r7k A:124-361)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978864Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 2978865Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 2978866Species Methanocaldococcus jannaschii [TaxId:2190] [160807] (4 PDB entries)
    Uniprot Q57600 124-361
  8. 2978868Domain d2r7ka2: 2r7k A:124-361 [151648]
    Other proteins in same PDB: d2r7ka1
    complexed with acp, amz, cl, so4

Details for d2r7ka2

PDB Entry: 2r7k (more details), 2.1 Å

PDB Description: crystal structure of faicar synthetase (purp) from m. jannaschii complexed with amppcp and aicar
PDB Compounds: (A:) 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase

SCOPe Domain Sequences for d2r7ka2:

Sequence, based on SEQRES records: (download)

>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfpgarggrgyfiassteefykkaedlk
krgiltdedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakd
qlemninpsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnen
lelvvfemsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

Sequence, based on observed residues (ATOM records): (download)

>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfpgargyfiassteefykkaedlkkrg
iltdedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakdqle
mninpsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnenlel
vvfemsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

SCOPe Domain Coordinates for d2r7ka2:

Click to download the PDB-style file with coordinates for d2r7ka2.
(The format of our PDB-style files is described here.)

Timeline for d2r7ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7ka1