Lineage for d2r7ja2 (2r7j A:2-143)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
consists of six alpha-helices and two beta-hairpinsSuperfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) 
Family d.216.1.1: Rotavirus NSP2 fragment, N-terminal domain [75575] (1 protein) Protein Rotavirus NSP2 fragment, N-terminal domain [75576] (1 species) Species Simian 11 rotavirus [TaxId:10923] [75577] (5 PDB entries) 
Domain d2r7ja2: 2r7j A:2-143 [151646]
Other proteins in same PDB: d2r7ja1
automatically matched to d1l9va2
mutant
Details for d2r7ja2
PDB Entry: 2r7j (more details), 2.6 Å
PDB Description: crystal structure of rotavirus non structural protein nsp2 with h225a mutation
PDB Compounds: (A:) Non-structural RNA-binding protein 35SCOPe Domain Sequences for d2r7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7ja2 d.216.1.1 (A:2-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
aelacfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkry
ntndnsrgmnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirkenp
qdilfhskdlllkstliaigqs
SCOPe Domain Coordinates for d2r7ja2:
Click to download the PDB-style file with coordinates for d2r7ja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r7ja2:
- d2r7ja2 first appeared in SCOP 1.75
- d2r7ja2 appears in SCOPe 2.05
- d2r7ja2 appears in SCOPe 2.07
- d2r7ja2 appears in the current release, SCOPe 2.08
View in 3D
