Lineage for d2r7ja2 (2r7j A:2-143)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446174Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
    consists of six alpha-helices and two beta-hairpins
  4. 1446175Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) (S)
  5. 1446176Family d.216.1.1: Rotavirus NSP2 fragment, N-terminal domain [75575] (1 protein)
  6. 1446177Protein Rotavirus NSP2 fragment, N-terminal domain [75576] (1 species)
  7. 1446178Species Simian 11 rotavirus [TaxId:10923] [75577] (5 PDB entries)
  8. 1446179Domain d2r7ja2: 2r7j A:2-143 [151646]
    Other proteins in same PDB: d2r7ja1
    automatically matched to d1l9va2
    mutant

Details for d2r7ja2

PDB Entry: 2r7j (more details), 2.6 Å

PDB Description: crystal structure of rotavirus non structural protein nsp2 with h225a mutation
PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOPe Domain Sequences for d2r7ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7ja2 d.216.1.1 (A:2-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
aelacfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkry
ntndnsrgmnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirkenp
qdilfhskdlllkstliaigqs

SCOPe Domain Coordinates for d2r7ja2:

Click to download the PDB-style file with coordinates for d2r7ja2.
(The format of our PDB-style files is described here.)

Timeline for d2r7ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7ja1