Lineage for d2r55a_ (2r55 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.0: automated matches [191339] (1 protein)
not a true familyProtein automated matches [190218] (19 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [255576] (2 PDB entries) 
Domain d2r55a_: 2r55 A: [243657]
automated match to d1jssa_
Details for d2r55a_
PDB Entry: 2r55 (more details), 2.5 Å
PDB Description: Human StAR-related lipid transfer protein 5
PDB Compounds: (A:) StAR-related lipid transfer protein 5SCOPe Domain Sequences for d2r55a_:
Sequence, based on SEQRES records: (download)
>d2r55a_ d.129.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqsmaaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtl
eevwdcvkpavgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvl
vkryedgtissnathvehplcppkpgfvrgfnhpcgcfceplpgeptktnlvtffhtdls
gylpqnvvdsffprsmtrfyanlqkavkqfhe
Sequence, based on observed residues (ATOM records): (download)
>d2r55a_ d.129.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqsmaaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtl
eevwdcvkpgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvlvk
ryedgtissnathvehplcppkpgfvrgfnhpcgcfceplpptktnlvtffhtdlsgylp
qnvvdsffprsmtrfyanlqkavkqfhe
SCOPe Domain Coordinates for d2r55a_:
Click to download the PDB-style file with coordinates for d2r55a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r55a_:
- d2r55a_ is new in SCOPe 2.04-stable
- d2r55a_ appears in SCOPe 2.05
- d2r55a_ appears in the current release, SCOPe 2.08, called d2r55a1
View in 3D
