Lineage for d2r4ia1 (2r4i A:1-122)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641368Family d.17.4.15: CHU142-like [159988] (1 protein)
    single domain covered by PfamB PB000743 in the N-terminal part and PfamB PB000860 in the C-terminal part
  6. 1641369Protein Uncharacterized protein CHU142 [159989] (1 species)
  7. 1641370Species Cytophaga hutchinsonii [TaxId:985] [159990] (1 PDB entry)
    Uniprot Q11V67 1-122
  8. 1641371Domain d2r4ia1: 2r4i A:1-122 [151576]
    complexed with cit, gol, ipa

Details for d2r4ia1

PDB Entry: 2r4i (more details), 1.6 Å

PDB Description: crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2r4ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}
mnqrdvildcekklltaiqnndveslevllhddllfiipsgetvtketdiaayssgkial
ravvpsdyiiriihdtvvvsvnieikgeymehtldntfrylrvwklfdgnwkviagscta
ig

SCOPe Domain Coordinates for d2r4ia1:

Click to download the PDB-style file with coordinates for d2r4ia1.
(The format of our PDB-style files is described here.)

Timeline for d2r4ia1: