Lineage for d2r2fa_ (2r2f A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) Protein Ribonucleotide reductase R2 [47257] (10 species) 
Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries) 
Domain d2r2fa_: 2r2f A: [16802]
complexed with feo
Details for d2r2fa_
PDB Entry: 2r2f (more details), 2.25 Å
PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium (oxidized)
PDB Compounds: (A:) protein (ribonucleoside-diphosphate reductase small chain)SCOPe Domain Sequences for d2r2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]}
srisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgl
tlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaaya
wseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntad
lirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyae
tgwvndvkaflcynankalmnlgyealfppemadvnpailaalspn
SCOPe Domain Coordinates for d2r2fa_:
Click to download the PDB-style file with coordinates for d2r2fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r2fa_:
- d2r2fa_ first appeared (with stable ids) in SCOP 1.55
- d2r2fa_ appears in SCOPe 2.07
View in 3D
