Lineage for d2r25a_ (2r25 A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) 
contains additional, fifth helix at the N-terminus
Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins) 
Protein Phosphorelay protein ypd1 [47231] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries) 
Domain d2r25a_: 2r25 A: [151529]
Other proteins in same PDB: d2r25b_
automated match to d1c03a_
complexed with bef, mg, na
Details for d2r25a_
PDB Entry: 2r25 (more details), 1.7 Å
PDB Description: complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
PDB Compounds: (A:) Phosphorelay intermediate protein YPD1SCOPe Domain Sequences for d2r25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r25a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
SCOPe Domain Coordinates for d2r25a_:
Click to download the PDB-style file with coordinates for d2r25a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r25a_:
- d2r25a_ first appeared in SCOP 1.75, called d2r25a1
- d2r25a_ appears in SCOPe 2.06
- d2r25a_ appears in the current release, SCOPe 2.08
View in 3D
