Lineage for d2r0hb_ (2r0h B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2051947Species Coprinus cinereus [188451] (2 PDB entries)
  8. 2051949Domain d2r0hb_: 2r0h B: [167905]
    automated match to d1ul9a_
    complexed with cto

Details for d2r0hb_

PDB Entry: 2r0h (more details), 1.9 Å

PDB Description: fungal lectin cgl3 in complex with chitotriose (chitotetraose)
PDB Compounds: (B:) CGL3 lectin

SCOPe Domain Sequences for d2r0hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0hb_ b.29.1.0 (B:) automated matches {Coprinus cinereus}
mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanv

SCOPe Domain Coordinates for d2r0hb_:

Click to download the PDB-style file with coordinates for d2r0hb_.
(The format of our PDB-style files is described here.)

Timeline for d2r0hb_: