Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein automated matches [254612] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255501] (4 PDB entries) |
Domain d2qy0a2: 2qy0 A:358-446 [238839] Other proteins in same PDB: d2qy0a3, d2qy0b_, d2qy0c3, d2qy0d_ automated match to d1md8a2 complexed with gol |
PDB Entry: 2qy0 (more details), 2.6 Å
SCOPe Domain Sequences for d2qy0a2:
Sequence, based on SEQRES records: (download)
>d2qy0a2 g.18.1.1 (A:358-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi wkneqkgekiprclpvcgkpvnpveqrqr
>d2qy0a2 g.18.1.1 (A:358-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} dcgqprnlpngdfrytttmgvntykariqyychepyykmqtrreseqgvytctaqgiwkn eqkgekiprclpvcgkpvnpveqrqr
Timeline for d2qy0a2: