Lineage for d2qxyb_ (2qxy B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. Protein automated matches [190131] (85 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)
  8. Domain d2qxyb_: 2qxy B: [205897]
    Other proteins in same PDB: d2qxya2
    automated match to d1xhfb_
    complexed with so4

Details for d2qxyb_

PDB Entry: 2qxy (more details), 1.95 Å

PDB Description: crystal structure of a response regulator from thermotoga maritima
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d2qxyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qxyb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
tptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfegeesl
nlirrireefpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiis

SCOPe Domain Coordinates for d2qxyb_ are not available.

Timeline for d2qxyb_:

Domains from other chains:
(mouse over for more information)
d2qxya1, d2qxya2