Lineage for d2qxxa_ (2qxx A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139747Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1139748Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1139760Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 1139796Species Mycobacterium tuberculosis [TaxId:83332] [188349] (2 PDB entries)
  8. 1139797Domain d2qxxa_: 2qxx A: [167874]
    automated match to d1xs1a_
    complexed with 1pe, mg, ttp

Details for d2qxxa_

PDB Entry: 2qxx (more details), 2 Å

PDB Description: Bifunctional dCTP deaminase: dUTPase from Mycobacterium tuberculosis in complex with dTTP
PDB Compounds: (A:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2qxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qxxa_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
rsyqnfirs

SCOPe Domain Coordinates for d2qxxa_:

Click to download the PDB-style file with coordinates for d2qxxa_.
(The format of our PDB-style files is described here.)

Timeline for d2qxxa_: