Lineage for d2qtra_ (2qtr A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468666Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2468667Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries)
  8. 2468668Domain d2qtra_: 2qtr A: [167799]
    automated match to d1kama_
    complexed with nxx, so4

Details for d2qtra_

PDB Entry: 2qtr (more details), 1.7 Å

PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase
PDB Compounds: (A:) Nicotinate (Nicotinamide) nucleotide adenylyltransferase

SCOPe Domain Sequences for d2qtra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtra_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

SCOPe Domain Coordinates for d2qtra_:

Click to download the PDB-style file with coordinates for d2qtra_.
(The format of our PDB-style files is described here.)

Timeline for d2qtra_: