Class b: All beta proteins [48724] (177 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species) duplication: contains two CUB domains separated by an EGF-like domain |
Species Human (Homo sapiens) [TaxId:9606] [110137] (2 PDB entries) Uniprot O00187 17-181 |
Domain d2qqma3: 2qqm A:145-263 [151222] Other proteins in same PDB: d2qqma1, d2qqma2 automated match to d2qqma3 complexed with ca, edo |
PDB Entry: 2qqm (more details), 2 Å
SCOPe Domain Sequences for d2qqma3:
Sequence, based on SEQRES records: (download)
>d2qqma3 b.23.1.1 (A:145-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdsnppggm fcrydrleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys
>d2qqma3 b.23.1.1 (A:145-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdggmfcry drleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys
Timeline for d2qqma3: