Lineage for d2qqma3 (2qqm A:145-263)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049212Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2049213Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2049214Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2049238Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
    duplication: contains two CUB domains separated by an EGF-like domain
  7. 2049239Species Human (Homo sapiens) [TaxId:9606] [110137] (2 PDB entries)
    Uniprot O00187 17-181
  8. 2049240Domain d2qqma3: 2qqm A:145-263 [151222]
    Other proteins in same PDB: d2qqma1, d2qqma2
    automated match to d2qqma3
    complexed with ca, edo

Details for d2qqma3

PDB Entry: 2qqm (more details), 2 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-1
PDB Compounds: (A:) Neuropilin-1

SCOPe Domain Sequences for d2qqma3:

Sequence, based on SEQRES records: (download)

>d2qqma3 b.23.1.1 (A:145-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdsnppggm
fcrydrleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys

Sequence, based on observed residues (ATOM records): (download)

>d2qqma3 b.23.1.1 (A:145-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdggmfcry
drleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys

SCOPe Domain Coordinates for d2qqma3:

Click to download the PDB-style file with coordinates for d2qqma3.
(The format of our PDB-style files is described here.)

Timeline for d2qqma3: