Lineage for d2qpva1 (2qpv A:1-133)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.8: Atu1531-like [160742] (3 proteins)
Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport
Protein Uncharacterized protein Atu1531 [160745] (1 species) Species Agrobacterium tumefaciens [TaxId:358] [160746] (1 PDB entry)
Uniprot Q7CZ16 1-133
Domain d2qpva1: 2qpv A:1-133 [151215]
complexed with acy
Details for d2qpva1
PDB Entry: 2qpv (more details), 2.35 Å
PDB Description: Crystal structure of uncharacterized protein Atu1531
PDB Compounds: (A:) Uncharacterized protein Atu1531SCOPe Domain Sequences for d2qpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]}
mpvmqsriihlsvekpwaevydfaanpgnmprwaaglaggleadgedwiakggplgevrv
nfaphnefgvidhvvtlpdglkvynalrvtpngsgtevsftllrlegmtdedfeqdasai
tadlemlksllea
SCOPe Domain Coordinates for d2qpva1:
Click to download the PDB-style file with coordinates for d2qpva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qpva1:
- d2qpva1 first appeared in SCOP 1.75
- d2qpva1 appears in SCOPe 2.02
- d2qpva1 appears in SCOPe 2.04
- d2qpva1 appears in the current release, SCOPe 2.08
View in 3D
