Lineage for d2qpnb_ (2qpn B:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.0: automated matches [191512] (1 protein)
not a true familyProtein automated matches [190857] (70 species)
not a true protein
Species Klebsiella pneumoniae [195749] (2 PDB entries) 
Domain d2qpnb_: 2qpn B: [195750]
automated match to d3ni9a_
complexed with so4
Details for d2qpnb_
PDB Entry: 2qpn (more details), 1.1 Å
PDB Description: GES-1 beta-lactamase
PDB Compounds: (B:) Beta-lactamase GES-1SCOPe Domain Sequences for d2qpnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpnb_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae}
sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
gpaamtqyfrkigdsvsrldrkepemgdntpgdlrdtttpiamartvakvlyggaltsts
thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
apklsaverdelvasvgqvitqlils
SCOPe Domain Coordinates for d2qpnb_:
Click to download the PDB-style file with coordinates for d2qpnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qpnb_:
- d2qpnb_ first appeared in SCOPe 2.02
- d2qpnb_ appears in SCOPe 2.07
View in 3D
