Lineage for d2qora_ (2qor A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850248Species Plasmodium vivax [TaxId:5855] [188009] (1 PDB entry)
  8. 1850249Domain d2qora_: 2qor A: [167745]
    automated match to d1ex6a_
    complexed with 5gp, pop

Details for d2qora_

PDB Entry: 2qor (more details), 1.8 Å

PDB Description: crystal structure of plasmodium vivax guanylate kinase
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d2qora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qora_ c.37.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
maripplvvcgpsgvgkgtlikkvlsefpsrfrfsiscttrnkreketngvdyyfvdkdd
ferklkegqflefdkyannfygtlkseydlavgegkiclfemningvkqlkeskhiqdgi
yifvkppsidillgrlknrntekpeeinkrmqeltremdeadkvgfnyfivnddlartya
elreyllgsypqlrgg

SCOPe Domain Coordinates for d2qora_:

Click to download the PDB-style file with coordinates for d2qora_.
(The format of our PDB-style files is described here.)

Timeline for d2qora_: