Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [189160] (2 PDB entries) |
Domain d2qmba_: 2qmb A: [167720] automated match to d1fawa_ complexed with hem, oxy |
PDB Entry: 2qmb (more details), 2.8 Å
SCOPe Domain Sequences for d2qmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmba_ a.1.1.2 (A:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]} vlsaadknnvkgiftkiaghaeeygaetlermfitypptktyfphfdlshgsaqikghgk kvvaalieaanhiddiagtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpaaltpe vhasldkflcavgtvltakyr
Timeline for d2qmba_: