Lineage for d2qlya3 (2qly A:650-731)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810929Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 [310752] (1 species)
  7. 2810930Species Human (Homo sapiens) [TaxId:9606] [311007] (3 PDB entries)
  8. 2810932Domain d2qlya3: 2qly A:650-731 [304424]
    Other proteins in same PDB: d2qlya1, d2qlya2, d2qlya4, d2qlya5
    complexed with gol, nag

Details for d2qlya3

PDB Entry: 2qly (more details), 2 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qlya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlya3 b.71.1.4 (A:650-731) N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 {Human (Homo sapiens) [TaxId: 9606]}
tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv
rwrkqkvemelpgdkiglhlrg

SCOPe Domain Coordinates for d2qlya3:

Click to download the PDB-style file with coordinates for d2qlya3.
(The format of our PDB-style files is described here.)

Timeline for d2qlya3: