Class a: All alpha proteins [46456] (284 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.8: Avirulence protein AvrPto [116854] (1 family) |
Family a.8.8.1: Avirulence protein AvrPto [116855] (1 protein) |
Protein Avirulence protein AvrPto [116856] (1 species) |
Species Pseudomonas syringae [TaxId:317] [116857] (2 PDB entries) Uniprot Q08242 29-133 |
Domain d2qkwa1: 2qkw A:29-129 [150848] automatically matched to d1r5ea_ |
PDB Entry: 2qkw (more details), 3.2 Å
SCOP Domain Sequences for d2qkwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkwa1 a.8.8.1 (A:29-129) Avirulence protein AvrPto {Pseudomonas syringae [TaxId: 317]} dnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqhr ymtgasginpgmlphenvddmrsaitdwsdmrealqhamgi
Timeline for d2qkwa1: