Lineage for d2qkwa1 (2qkw A:29-129)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 764418Superfamily a.8.8: Avirulence protein AvrPto [116854] (1 family) (S)
  5. 764419Family a.8.8.1: Avirulence protein AvrPto [116855] (1 protein)
  6. 764420Protein Avirulence protein AvrPto [116856] (1 species)
  7. 764421Species Pseudomonas syringae [TaxId:317] [116857] (2 PDB entries)
    Uniprot Q08242 29-133
  8. 764422Domain d2qkwa1: 2qkw A:29-129 [150848]
    automatically matched to d1r5ea_

Details for d2qkwa1

PDB Entry: 2qkw (more details), 3.2 Å

PDB Description: Structural basis for activation of plant immunity by bacterial effector protein AvrPto
PDB Compounds: (A:) Avirulence protein

SCOP Domain Sequences for d2qkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkwa1 a.8.8.1 (A:29-129) Avirulence protein AvrPto {Pseudomonas syringae [TaxId: 317]}
dnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqhr
ymtgasginpgmlphenvddmrsaitdwsdmrealqhamgi

SCOP Domain Coordinates for d2qkwa1:

Click to download the PDB-style file with coordinates for d2qkwa1.
(The format of our PDB-style files is described here.)

Timeline for d2qkwa1: