Lineage for d2qifb_ (2qif B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653690Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1653691Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1653787Protein automated matches [190409] (4 species)
    not a true protein
  7. 1653788Species Bacillus subtilis [TaxId:1423] [189117] (3 PDB entries)
  8. 1653790Domain d2qifb_: 2qif B: [150809]
    automated match to d1k0va_
    complexed with act, ca, cu1, gol

Details for d2qifb_

PDB Entry: 2qif (more details), 1.5 Å

PDB Description: crystal structure of a metallochaperone with a tetranuclear cu(i) cluster
PDB Compounds: (B:) Copper chaperone copZ

SCOPe Domain Sequences for d2qifb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qifb_ d.58.17.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydva

SCOPe Domain Coordinates for d2qifb_:

Click to download the PDB-style file with coordinates for d2qifb_.
(The format of our PDB-style files is described here.)

Timeline for d2qifb_:

1653790
d2qifb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2qifa_