Lineage for d2qg5d_ (2qg5 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932641Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries)
  8. 1932646Domain d2qg5d_: 2qg5 D: [205809]
    automated match to d4eomc_

Details for d2qg5d_

PDB Entry: 2qg5 (more details), 2.3 Å

PDB Description: Cryptosporidium parvum calcium dependent protein kinase cgd7_1840
PDB Compounds: (D:) calcium/calmodulin-dependent protein kinase

SCOPe Domain Sequences for d2qg5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qg5d_ d.144.1.0 (D:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hhhhhssgrenlyfqgstkgdinqyytlentigrgswgevkiavqkgtrirraakkipky
fvedvdrfkqeieimksldhpniirlyetfedntdiylvmelctggelfervvhkrvfre
sdaarimkdvlsavaychklnvahrdlkpenflfltdspdsplklidfglaarfkpgkmm
rtkvgtpyyvspqvleglygpecdewsagvmmyvllcgyppfsaptdsevmlkiregtft
fpekdwlnvspqaeslirrlltkspkqritslqalehewfekql

SCOPe Domain Coordinates for d2qg5d_:

Click to download the PDB-style file with coordinates for d2qg5d_.
(The format of our PDB-style files is described here.)

Timeline for d2qg5d_: