Lineage for d2qe7e3 (2qe7 E:350-462)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. Protein automated matches [254528] (17 species)
    not a true protein
  7. Species Bacillus sp. [TaxId:90973] [255561] (1 PDB entry)
  8. Domain d2qe7e3: 2qe7 E:350-462 [243550]
    Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7b1, d2qe7b2, d2qe7c1, d2qe7c2, d2qe7d1, d2qe7d2, d2qe7e1, d2qe7e2, d2qe7f1, d2qe7f2, d2qe7g_
    automated match to d1skye1

Details for d2qe7e3

PDB Entry: 2qe7 (more details), 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2qe7e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qe7e3 a.69.1.0 (E:350-462) automated matches {Bacillus sp. [TaxId: 90973]}
avvgeehyrvargvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhv
aeqftgmpgkyvpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl

SCOPe Domain Coordinates for d2qe7e3 are not available.

Timeline for d2qe7e3:

Domains from same chain:
(mouse over for more information)
d2qe7e1, d2qe7e2
Domains from other chains:
(mouse over for more information)
d2qe7a1, d2qe7a2, d2qe7a3, d2qe7b1, d2qe7b2, d2qe7b3, d2qe7c1, d2qe7c2, d2qe7c3, d2qe7d1, d2qe7d2, d2qe7d3, d2qe7f1, d2qe7f2, d2qe7f3, d2qe7g_