Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries) Uniprot P00720 many mutant structures |
Domain d2qarc_: 2qar C: [167498] Other proteins in same PDB: d2qara_, d2qarb_, d2qard_, d2qare_ automated match to d139la_ complexed with nh4, no3 |
PDB Entry: 2qar (more details), 2.4 Å
SCOPe Domain Sequences for d2qarc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qarc_ d.2.1.3 (C:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} gpnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvit kdeaeklfcqdvdaavrgilrnaklkpvydsldcvrrcalinmvfqmgetgvagftnslr mlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
Timeline for d2qarc_: