Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (3 families) |
Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins) automatically mapped to Pfam PF00740 |
Protein automated matches [190920] (7 species) not a true protein |
Species Adeno-associated virus - 8 [TaxId:202813] [188409] (5 PDB entries) |
Domain d2qa0a_: 2qa0 A: [167486] automated match to d1lp3a_ complexed with na |
PDB Entry: 2qa0 (more details), 2.6 Å
SCOPe Domain Sequences for d2qa0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qa0a_ b.121.5.2 (A:) automated matches {Adeno-associated virus - 8 [TaxId: 202813]} dgvgsssgnwhcdstwlgdrvittstrtwalptynnhlykqisngtsggatndntyfgys tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlsfklfniqvkevtqnegtktiannl tstiqvftdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycle yfpsqmlrtgnnfqftytfedvpfhssyahsqsldrlmnplidqylyylsrtqttggtan tqtlgfsqggpntmanqaknwlpgpcyrqqrvstttgqnnnsnfawtagtkyhlngrnsl anpgiamathkddeerffpsngilifgkqnaardnadysdvmltseeeikttnpvateey givadnlqqqntapqigtvnsqgalpgmvwqnrdvylqgpiwakiphtdgnfhpsplmgg fglkhpppqilikntpvpadppttfnqsklnsfitqystgqvsveiewelqkenskrwnp eiqytsnyykstsvdfavntegvyseprpigtryltrnl
Timeline for d2qa0a_: