Lineage for d2q6ka2 (2q6k A:177-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824820Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2824821Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2824864Family b.141.1.0: automated matches [227220] (1 protein)
    not a true family
  6. 2824865Protein automated matches [226959] (4 species)
    not a true protein
  7. 2824866Species Salinispora tropica [TaxId:369723] [225387] (6 PDB entries)
  8. 2824867Domain d2q6ka2: 2q6k A:177-271 [205758]
    Other proteins in same PDB: d2q6ka1
    automated match to d1rqpa1
    complexed with adn, peg

Details for d2q6ka2

PDB Entry: 2q6k (more details), 1.55 Å

PDB Description: SalL with adenosine
PDB Compounds: (A:) chlorinase

SCOPe Domain Sequences for d2q6ka2:

Sequence, based on SEQRES records: (download)

>d2q6ka2 b.141.1.0 (A:177-271) automated matches {Salinispora tropica [TaxId: 369723]}
gevvridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelpfcktfgevdegqp
llylnsrgrlalglnqsnfiekwpvvpgdsitvsp

Sequence, based on observed residues (ATOM records): (download)

>d2q6ka2 b.141.1.0 (A:177-271) automated matches {Salinispora tropica [TaxId: 369723]}
gevvridrafgnvwtnipthligrlevkilsdtvlelpfcktfgevdegqpllylnsrgr
lalglnqsnfiekwpvvpgdsitvsp

SCOPe Domain Coordinates for d2q6ka2:

Click to download the PDB-style file with coordinates for d2q6ka2.
(The format of our PDB-style files is described here.)

Timeline for d2q6ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q6ka1