Lineage for d2q5we1 (2q5w E:2-137)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. Protein automated matches [191185] (7 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:1280] [255555] (2 PDB entries)
  8. Domain d2q5we1: 2q5w E:2-137 [243523]
    Other proteins in same PDB: d2q5we2
    automated match to d2wp4a_
    complexed with gol

Details for d2q5we1

PDB Entry: 2q5w (more details), 2 Å

PDB Description: the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus
PDB Compounds: (E:) Molybdopterin-converting factor subunit 2

SCOPe Domain Sequences for d2q5we1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q5we1 d.41.5.0 (E:2-137) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkqfeiviepiqteqyreftineyqgavvvftghvrewtkgvkteyleyeayipmaekkl
aqigdeinekwpgtitsivhrigplqisdiavliavssphrkdayraneyaierikeivp
iwkkeiwedgskwqgh

SCOPe Domain Coordinates for d2q5we1 are not available.

Timeline for d2q5we1:

Domains from same chain:
(mouse over for more information)
d2q5we2