Lineage for d2q4fa_ (2q4f A:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) 
contains additional, fifth helix at the N-terminus
Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins) 
Protein Histidine-containing phosphotransfer protein HP1 [140413] (1 species) Species Rice (Oryza sativa) [TaxId:4530] [140414] (2 PDB entries)
Uniprot Q6VAK4 2-143
Domain d2q4fa_: 2q4f A: [139847]
automated match to d1yvia1
Details for d2q4fa_
PDB Entry: 2q4f (more details), 2 Å
PDB Description: Ensemble refinement of the crystal structure of putative histidine-containing phosphotransfer protein from rice, Ak104879
PDB Compounds: (A:) Histidine-containing phosphotransfer protein 1SCOPe Domain Sequences for d2q4fa_:
Sequence, based on SEQRES records: (download)
>d2q4fa_ a.24.10.2 (A:) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
saaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriine
iatlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavv
rndfydlrnkfqtmlqleqqiqa
Sequence, based on observed residues (ATOM records): (download)
>d2q4fa_ a.24.10.2 (A:) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
saaaalrdqltallssmfsqglvdeqfqqlqmlqdtpgfvsevvtlfcddadriineiat
lleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrnd
fydlrnkfqtmlqleqqiqa
SCOPe Domain Coordinates for d2q4fa_:
Click to download the PDB-style file with coordinates for d2q4fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2q4fa_:
- d2q4fa_ first appeared in SCOP 1.73, called d2q4fa1
- d2q4fa_ appears in SCOPe 2.02
- d2q4fa_ appears in SCOPe 2.04
- d2q4fa_ appears in the current release, SCOPe 2.08, called d2q4fa2
View in 3D
