Lineage for d2q2ia_ (2q2i A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) 
Family b.40.4.0: automated matches [191416] (1 protein)
not a true familyProtein automated matches [190576] (33 species)
not a true protein
Species Agrobacterium tumefaciens [TaxId:176299] [188408] (2 PDB entries) 
Domain d2q2ia_: 2q2i A: [167395]
automated match to d1gd7a_
complexed with edo, so4
Details for d2q2ia_
PDB Entry: 2q2i (more details), 1.55 Å
PDB Description: Crystal structure of the protein secretion chaperone CsaA from Agrobacterium tumefaciens.
PDB Compounds: (A:) Secretion chaperoneSCOPe Domain Sequences for d2q2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q2ia_ b.40.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
sgeisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhytpes
lvgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc
SCOPe Domain Coordinates for d2q2ia_:
Click to download the PDB-style file with coordinates for d2q2ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2q2ia_:
- d2q2ia_ first appeared in SCOPe 2.01
- d2q2ia_ appears in SCOPe 2.05
- d2q2ia_ appears in SCOPe 2.07
- d2q2ia_ appears in the current release, SCOPe 2.08
View in 3D
