Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (22 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [188408] (2 PDB entries) |
Domain d2q2hb_: 2q2h B: [195196] automated match to d2q2ia_ complexed with act, cit |
PDB Entry: 2q2h (more details), 1.65 Å
SCOPe Domain Sequences for d2q2hb_:
Sequence, based on SEQRES records: (download)
>d2q2hb_ b.40.4.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} geisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhytpesl vgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc
>d2q2hb_ b.40.4.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} geisyadfekvdirvgtiveavpfpaikvkidfgpeigikkssaqitvhytpeslvgrqv lgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc
Timeline for d2q2hb_: