Lineage for d2q0va_ (2q0v A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1407249Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1407250Protein automated matches [190120] (5 species)
    not a true protein
  7. 1407270Species Plasmodium falciparum [TaxId:36329] [187332] (2 PDB entries)
  8. 1407271Domain d2q0va_: 2q0v A: [167384]
    automated match to d1jatb_
    complexed with po4

Details for d2q0va_

PDB Entry: 2q0v (more details), 2.4 Å

PDB Description: crystal structure of ubiquitin conjugating enzyme e2, putative, from plasmodium falciparum
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2, putative

SCOPe Domain Sequences for d2q0va_:

Sequence, based on SEQRES records: (download)

>d2q0va_ d.20.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
nlyfqgivprsfrlldelergqkgnvsegvsfglesadditlsnwsctifgqpgtvfenr
iysltifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwnrnytietilisl
rqemlssankrlpqpnegevy

Sequence, based on observed residues (ATOM records): (download)

>d2q0va_ d.20.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
nlyfqgivprsfrlldelergqkgvsegvsfglesadditlsnwsctifgqpgtvfenri
ysltifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwnrnytietilislr
qemlssankrlpqpnegevy

SCOPe Domain Coordinates for d2q0va_:

Click to download the PDB-style file with coordinates for d2q0va_.
(The format of our PDB-style files is described here.)

Timeline for d2q0va_: