SCOPe 2.08: Domain d2pzza1: 2pzz A:3-134

Lineage for d2pzza1 (2pzz A:3-134)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.77: RL5-like [55281] (1 superfamily)
beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
Superfamily d.77.1: RL5-like [55282] (3 families)
Family d.77.1.2: SSO1042-like [160489] (5 proteins)
Pfam PF01877; DUF54
Protein Hypotheical protein MJ1564 [160496] (1 species)
Species Methanocaldococcus jannaschii [TaxId:2190] [160497] (1 PDB entry)
Uniprot Q58959 1-133
Domain d2pzza1: 2pzz A:3-134 [149977]
Other proteins in same PDB: d2pzza2, d2pzzb2, d2pzzc2, d2pzzd2

Details for d2pzza1

PDB Entry: 2pzz (more details), 2.2 Å

PDB Description: 2.2 a resolution crystal structure of upf0201 protein from methanococcus jannaschii

PDB Compounds: (A:) UPF0201 protein MJ1564

SCOPe Domain Sequences for d2pzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzza1 d.77.1.2 (A:3-134) Hypotheical protein MJ1564 {Methanocaldococcus jannaschii [TaxId: 2190]}
eviikakvkptedkykvkkailnifpkakltfiekdnefgewegktksveklkellrsqs
ildaarmvlekgmtenatkfylnkqaayvgavnfdidthggifvkiladenedimkiikd
iaprtkggviin

SCOPe Domain Coordinates for d2pzza1:

Click to download the PDB-style file with coordinates for d2pzza1.
(The format of our PDB-style files is described here.)

Timeline for d2pzza1: