Lineage for d2pytb_ (2pyt B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topologySuperfamily b.82.1: RmlC-like cupins [51182] (25 families) 
Family b.82.1.24: EutQ-like [159304] (1 protein)
Pfam PF06249Protein Ethanolamine utilization protein EutQ [159305] (1 species) Species Salmonella typhimurium [TaxId:90371] [159306] (1 PDB entry)
Uniprot Q9ZFV5 100-227
Domain d2pytb_: 2pyt B: [149958]
automated match to d2pyta1
Details for d2pytb_
PDB Entry: 2pyt (more details), 1.9 Å
PDB Description: crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution
PDB Compounds: (B:) Ethanolamine utilization protein eutQSCOPe Domain Sequences for d2pytb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pytb_ b.82.1.24 (B:) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]}
gtmqpsftsvtgkggvkvidgssvkfgrfdgaephcvgltdlvteqdgssmaagfmqwdn
affpwtlnydeidmvlegelhvrhegetmiakagdvmfipkgssiefgtptsvrflyvaw
pan
SCOPe Domain Coordinates for d2pytb_:
Click to download the PDB-style file with coordinates for d2pytb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pytb_:
- d2pytb_ first appeared in SCOP 1.75, called d2pytb1
- d2pytb_ appears in SCOPe 2.07
View in 3D
