Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (17 PDB entries) |
Domain d2pyoc_: 2pyo C: [198265] Other proteins in same PDB: d2pyoa_, d2pyob_, d2pyoe_, d2pyof_ automated match to d3lelg_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 2pyo (more details), 2.43 Å
SCOPe Domain Sequences for d2pyoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyoc_ a.22.1.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aksrsnraglqfpvgrihrllrkgnyaervgagapvylaavmeylaaevlelagnaardn kktriiprhlqlairndeelnkllsgvtiaqggvlpniqavllpkkte
Timeline for d2pyoc_: