Lineage for d2pxwb_ (2pxw B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.0: automated matches [191400] (1 protein)
not a true familyProtein automated matches [190526] (26 species)
not a true protein
Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries) 
Domain d2pxwb_: 2pxw B: [194432]
automated match to d1xssb_
mutant
Details for d2pxwb_
PDB Entry: 2pxw (more details), 2.4 Å
PDB Description: crystal structure of n66d mutant of green fluorescent protein from zoanthus sp. at 2.4 a resolution (transition state)
PDB Compounds: (B:) GFP-like fluorescent chromoprotein FP506SCOPe Domain Sequences for d2pxwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pxwb_ d.22.1.0 (B:) automated matches {Zoanthus sp. [TaxId: 105402]}
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp
SCOPe Domain Coordinates for d2pxwb_:
Click to download the PDB-style file with coordinates for d2pxwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pxwb_:
- d2pxwb_ first appeared in SCOPe 2.02
- d2pxwb_ appears in SCOPe 2.07
View in 3D
