Lineage for d2pxha_ (2pxh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590101Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1590329Protein automated matches [190581] (8 species)
    not a true protein
  7. 1590339Species Methanocaldococcus jannaschii [TaxId:2190] [188187] (8 PDB entries)
  8. 1590341Domain d2pxha_: 2pxh A: [167329]
    automated match to d1j1ua_
    complexed with bp5

Details for d2pxha_

PDB Entry: 2pxh (more details), 1.97 Å

PDB Description: crystal structure of a bipyridylalanyl-trna synthetase
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2pxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxha_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagfd
iiiyladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimevngwhysgvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrll

SCOPe Domain Coordinates for d2pxha_:

Click to download the PDB-style file with coordinates for d2pxha_.
(The format of our PDB-style files is described here.)

Timeline for d2pxha_: