Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.25: mRNA cap methylase [88785] (4 proteins) |
Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species) structurally and functionally similar to VP39 |
Species Murray valley encephalitis virus (strain mve-1-51) [TaxId:301478] [187362] (6 PDB entries) |
Domain d2px8b_: 2px8 B: [167325] automated match to d1r6aa_ complexed with 3po, cl, gol, mgt, sah |
PDB Entry: 2px8 (more details), 2.2 Å
SCOPe Domain Sequences for d2px8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2px8b_ c.66.1.25 (B:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Murray valley encephalitis virus (strain mve-1-51) [TaxId: 301478]} grtlgeqwkeklnamgkeeffsyrkeailevdrtearrarregnkvgghpvsrgtaklrw lverrfvqpigkvvdlgcgrggwsyyaatmknvqevrgytkggpgheepmlmqsygwniv tmksgvdvfykpseisdtllcdigesspsaeieeqrtlrilemvsdwlsrgpkefcikil cpympkviekleslqrrfggglvrvplsrnsnhemywvsgasgnivhavnmtsqvligrm dkkiwkgpkyeedvnlgsgtravgk
Timeline for d2px8b_: