Lineage for d2px8b_ (2px8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893583Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
    structurally and functionally similar to VP39
  7. 2893593Species Murray valley encephalitis virus (strain mve-1-51) [TaxId:301478] [187362] (6 PDB entries)
  8. 2893596Domain d2px8b_: 2px8 B: [167325]
    automated match to d1r6aa_
    complexed with 3po, cl, gol, mgt, sah

Details for d2px8b_

PDB Entry: 2px8 (more details), 2.2 Å

PDB Description: Crystal structure of the Murray Valley Encephalitis Virus NS5 2'-O Methyltransferase domain in complex with SAH and 7M-GTP
PDB Compounds: (B:) Genome polyprotein [Contains: Capsid protein C (Core protein); Envelope protein M (Matrix protein); Major envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Flavivirin protease NS3 catalytic subunit; Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5)]

SCOPe Domain Sequences for d2px8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2px8b_ c.66.1.25 (B:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Murray valley encephalitis virus (strain mve-1-51) [TaxId: 301478]}
grtlgeqwkeklnamgkeeffsyrkeailevdrtearrarregnkvgghpvsrgtaklrw
lverrfvqpigkvvdlgcgrggwsyyaatmknvqevrgytkggpgheepmlmqsygwniv
tmksgvdvfykpseisdtllcdigesspsaeieeqrtlrilemvsdwlsrgpkefcikil
cpympkviekleslqrrfggglvrvplsrnsnhemywvsgasgnivhavnmtsqvligrm
dkkiwkgpkyeedvnlgsgtravgk

SCOPe Domain Coordinates for d2px8b_:

Click to download the PDB-style file with coordinates for d2px8b_.
(The format of our PDB-style files is described here.)

Timeline for d2px8b_: