Lineage for d2pvfa_ (2pvf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981442Protein Fibroblast growth factor receptor 2 [75562] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981443Species Human (Homo sapiens) [TaxId:9606] [75563] (16 PDB entries)
    Uniprot P21802 467-765
  8. 2981444Domain d2pvfa_: 2pvf A: [194426]
    automated match to d3b2tb_
    complexed with acp, mg

Details for d2pvfa_

PDB Entry: 2pvf (more details), 1.8 Å

PDB Description: crystal structure of tyrosine phosphorylated activated fgf receptor 2 (fgfr2) kinase domain in complex with atp analog and substrate peptide
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2pvfa_:

Sequence, based on SEQRES records: (download)

>d2pvfa_ d.144.1.7 (A:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfg
lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt

Sequence, based on observed residues (ATOM records): (download)

>d2pvfa_ d.144.1.7 (A:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpvtvavkmlkddatekdls
dlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmeysyq
mtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyy
kkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllk
eghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt

SCOPe Domain Coordinates for d2pvfa_:

Click to download the PDB-style file with coordinates for d2pvfa_.
(The format of our PDB-style files is described here.)

Timeline for d2pvfa_: