![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein automated matches [190352] (8 species) not a true protein |
![]() | Species Purple sea urchin (Strongylocentrotus purpuratus) [TaxId:7668] [188850] (1 PDB entry) |
![]() | Domain d2ptma_: 2ptm A: [167269] automated match to d1q5oa_ complexed with cmp, nco |
PDB Entry: 2ptm (more details), 1.93 Å
SCOPe Domain Sequences for d2ptma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ptma_ b.82.3.2 (A:) automated matches {Purple sea urchin (Strongylocentrotus purpuratus) [TaxId: 7668]} dsssrqyreklkqveeymqyrklpshlrnkildyyeyryrgkmfderhifrevsesirqd vanyncrdlvasvpffvgadsnfvtrvvtllefevfqpadyviqegtfgdrmffiqqgiv diimsdgviatslsdgsyfgeiclltrerrvasvkcetyctlfslsvqhfnqvldefpam rktmeeiavrrl
Timeline for d2ptma_: