Lineage for d2ptha_ (2pth A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889283Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 proteins)
    automatically mapped to Pfam PF01195
  6. 2889289Protein Peptidyl-tRNA hydrolase [53180] (1 species)
  7. 2889290Species Escherichia coli [TaxId:562] [53181] (1 PDB entry)
  8. 2889291Domain d2ptha_: 2pth A: [33793]

Details for d2ptha_

PDB Entry: 2pth (more details), 1.2 Å

PDB Description: peptidyl-trna hydrolase from escherichia coli
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2ptha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptha_ c.56.3.1 (A:) Peptidyl-tRNA hydrolase {Escherichia coli [TaxId: 562]}
tiklivglanpgaeyaatrhnagawfvdllaerlraplreeakffgytsrvtlggedvrl
lvpttfmnlsgkavaamasffrinpdeilvahdeldlppgvakfklggghgghnglkdii
sklgnnpnfhrlrigighpgdknkvvgfvlgkppvseqklideaideaarctemwftdgl
tkatnrlhafkaq

SCOPe Domain Coordinates for d2ptha_:

Click to download the PDB-style file with coordinates for d2ptha_.
(The format of our PDB-style files is described here.)

Timeline for d2ptha_: