Lineage for d2prga_ (2prg A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (168 PDB entries)
    Uniprot P37231 232-505
  8. Domain d2prga_: 2prg A: [19311]
    Other proteins in same PDB: d2prgc_
    complexed with brl

Details for d2prga_

PDB Entry: 2prg (more details), 2.3 Å

PDB Description: ligand-binding domain of the human peroxisome proliferator activated receptor gamma
PDB Compounds: (A:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d2prga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d2prga_ are not available.

Timeline for d2prga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2prgb_, d2prgc_