Lineage for d2pr9a1 (2pr9 A:159-435)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1113271Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 1113272Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)
  6. 1113273Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)
  7. 1113276Species Norway rat (Rattus norvegicus) [TaxId:10116] [49450] (6 PDB entries)
  8. 1113277Domain d2pr9a1: 2pr9 A:159-435 [149799]
    automatically matched to d1bw8a_

Details for d2pr9a1

PDB Entry: 2pr9 (more details), 2.51 Å

PDB Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with gabaa receptor-gamma2 subunit-derived internalization peptide deeygyecl
PDB Compounds: (A:) ap-2 complex subunit mu-1

SCOPe Domain Sequences for d2pr9a1:

Sequence, based on SEQRES records: (download)

>d2pr9a1 b.2.7.1 (A:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kiviekqgkgtadetsksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryr
ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm
kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg
lkvrylkvfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records): (download)

>d2pr9a1 b.2.7.1 (A:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kkqsiaiddctfhqcvrlsrsisfippdgefelmryrttkdiilpfrviplvrevgrtkl
evkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmagm
kesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvikw
vryigrsgiyetrc

SCOPe Domain Coordinates for d2pr9a1:

Click to download the PDB-style file with coordinates for d2pr9a1.
(The format of our PDB-style files is described here.)

Timeline for d2pr9a1: