| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (59 species) not a true protein |
| Species Mesorhizobium loti [TaxId:266835] [225267] (1 PDB entry) |
| Domain d2poza2: 2poz A:119-384 [205572] Other proteins in same PDB: d2poza1, d2pozb1, d2pozc1, d2pozd1, d2poze1, d2pozf1, d2pozg1, d2pozh1 automated match to d2gl5a1 |
PDB Entry: 2poz (more details), 2.04 Å
SCOPe Domain Sequences for d2poza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2poza2 c.1.11.0 (A:119-384) automated matches {Mesorhizobium loti [TaxId: 266835]}
kirdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsms
aeaielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfd
ngalkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamae
aynmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyf
empngpglgavlikrniepylwasct
Timeline for d2poza2: