| Class g: Small proteins [56992] (100 folds) |
| Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
| Family g.50.1.2: PHD domain [57911] (14 proteins) |
| Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries) |
| Domain d2pnxa1: 2pnx A:195-245 [149708] automatically matched to d1wena_ complexed with zn |
PDB Entry: 2pnx (more details), 1.8 Å
SCOPe Domain Sequences for d2pnxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqe
Timeline for d2pnxa1: