Lineage for d2pmic_ (2pmi C:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.0: automated matches [191359] (1 protein)
not a true familyProtein automated matches [190417] (35 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (23 PDB entries) 
Domain d2pmic_: 2pmi C: [167218]
automated match to d1e9hc_
complexed with ags, mes
Details for d2pmic_
PDB Entry: 2pmi (more details), 2.9 Å
PDB Description: Structure of the Pho85-Pho80 CDK-cyclin Complex of the Phosphate-responsive Signal Transduction Pathway with Bound ATP-gamma-S
PDB Compounds: (C:) Cyclin-dependent protein kinase PHO85SCOPe Domain Sequences for d2pmic_:
Sequence, based on SEQRES records: (download)
>d2pmic_ d.144.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfkqleklgngtyatvykglnkttgvyvalkevkldseegtpstaireislmkelkheni
vrlydvihtenkltlvfefmdndlkkymdsrtvgntprglelnlvkyfqwqllqglafch
enkilhrdlkpqnllinkrgqlklgdfglarafgipvntfssevvtlwyrapdvlmgsrt
ystsidiwscgcilaemitgkplfpgtndeeqlklifdimgtpneslwpsvtklpkynpn
iqqrpprdlrqvlqphtkepldgnlmdflhgllqlnpdmrlsakqalhhpwfaeyy
Sequence, based on observed residues (ATOM records): (download)
>d2pmic_ d.144.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfkqlektvykglnkttgvyvalkevkegtpstaireislmkelkhenivrlydvihten
kltlvfefmdndlkkymdsrtvgntprglelnlvkyfqwqllqglafchenkilhrdlkp
qnllinkrgqlklgdfglarafgipvntfssevvtlwyrapdvlmgsrtystsidiwscg
cilaemitgkplfpgtndeeqlklifdimgtpneslwpsvtklpkynpniqqrpprdlrq
vlqphtkepldgnlmdflhgllqlnpdmrlsakqalhhpwfaeyy
SCOPe Domain Coordinates for d2pmic_:
Click to download the PDB-style file with coordinates for d2pmic_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pmic_:
- d2pmic_ first appeared in SCOPe 2.01
- d2pmic_ appears in SCOPe 2.06
- d2pmic_ appears in the current release, SCOPe 2.08
View in 3D
