Lineage for d2plaa2 (2pla A:196-346)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.0: automated matches [227147] (1 protein)
not a true familyProtein automated matches [226851] (30 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries) 
Domain d2plaa2: 2pla A:196-346 [231159]
Other proteins in same PDB: d2plaa1, d2plab1
automated match to d1x0xa2
complexed with cl, nad, po4
Details for d2plaa2
PDB Entry: 2pla (more details), 2.51 Å
PDB Description: crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase 1-like proteinSCOPe Domain Sequences for d2plaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plaa2 a.100.1.0 (A:196-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adtvelcgalknivavgagfcdglrcgdntkaavirlglmemiafarifckgqvstatfl
escgvadlittcyggrnrrvaeafartgktieelekemlngqklqgpqtsaevyrilkqk
glldkfplftavyqicyesrpvqemlsclqs
SCOPe Domain Coordinates for d2plaa2:
Click to download the PDB-style file with coordinates for d2plaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2plaa2:
- d2plaa2 first appeared in SCOPe 2.03
- d2plaa2 appears in SCOPe 2.04
- d2plaa2 appears in SCOPe 2.06
- d2plaa2 appears in the current release, SCOPe 2.08
View in 3D
