Lineage for d2plaa2 (2pla A:196-346)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721729Domain d2plaa2: 2pla A:196-346 [231159]
    Other proteins in same PDB: d2plaa1, d2plab1
    automated match to d1x0xa2
    complexed with cl, nad, po4

Details for d2plaa2

PDB Entry: 2pla (more details), 2.51 Å

PDB Description: crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase 1-like protein

SCOPe Domain Sequences for d2plaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plaa2 a.100.1.0 (A:196-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adtvelcgalknivavgagfcdglrcgdntkaavirlglmemiafarifckgqvstatfl
escgvadlittcyggrnrrvaeafartgktieelekemlngqklqgpqtsaevyrilkqk
glldkfplftavyqicyesrpvqemlsclqs

SCOPe Domain Coordinates for d2plaa2:

Click to download the PDB-style file with coordinates for d2plaa2.
(The format of our PDB-style files is described here.)

Timeline for d2plaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2plaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2plab1