Lineage for d2pl5a1 (2pl5 A:5-366)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152662Family c.69.1.40: O-acetyltransferase [159756] (2 proteins)
  6. 2152701Protein Homoserine O-acetyltransferase [159759] (2 species)
  7. 2152704Species Leptospira interrogans [TaxId:173] [159760] (1 PDB entry)
    Uniprot Q8F4I0 5-366
  8. 2152705Domain d2pl5a1: 2pl5 A:5-366 [149611]
    complexed with gol

Details for d2pl5a1

PDB Entry: 2pl5 (more details), 2.2 Å

PDB Description: Crystal Structure of Homoserine O-acetyltransferase from Leptospira interrogans
PDB Compounds: (A:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d2pl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]}
gsigiietkyaefkelilnngsvlspvviayetygtlsssknnailichalsgdahaagy
hsgsdkkpgwwddyigpgksfdtnqyfiicsnviggckgssgplsihpetstpygsrfpf
vsiqdmvkaqkllveslgieklfcvaggsmggmqalewsiaypnslsncivmastaehsa
mqiafnevgrqailsdpnwknglydensprkglalarmvghitylsddkmrekfgrnppr
gnilstdfavgsyliyqgesfvdrfdansyiyvtkaldhyslgkgkeltaalsnatcrfl
vvsyssdwlyppaqsreivksleaadkrvfyvelqsgeghdsfllknpkqieilkgflen
pn

SCOPe Domain Coordinates for d2pl5a1:

Click to download the PDB-style file with coordinates for d2pl5a1.
(The format of our PDB-style files is described here.)

Timeline for d2pl5a1: