Lineage for d2pkyx_ (2pky X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151248Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2151249Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2151269Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)
  8. 2151272Domain d2pkyx_: 2pky X: [149608]
    automated match to d1b6ga_

Details for d2pkyx_

PDB Entry: 2pky (more details), 1.55 Å

PDB Description: The Effect of Deuteration on Protein Structure A High Resolution Comparison of Hydrogenous and Perdeuterated Haloalkane Dehalogenase
PDB Compounds: (X:) haloalkane dehalogenase

SCOPe Domain Sequences for d2pkyx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkyx_ c.69.1.8 (X:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
inairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptwsy
lyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitlv
vqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlvt
psdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidisteai
sfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvare
alkhfaet

SCOPe Domain Coordinates for d2pkyx_:

Click to download the PDB-style file with coordinates for d2pkyx_.
(The format of our PDB-style files is described here.)

Timeline for d2pkyx_: